quattro Separator @4_Separator
Better Separation Through Research [email protected] quattroseparator.com Ancona Joined December 2013-
Tweets20
-
Followers34
-
Following126
-
Likes25
La tecnologia TCR (Thermo Catalytic Reforming) trasforma i fanghi di depurazione, e non solo, in biochar, idrogeno verde e biocarburanti, da utilizzare tal quali in motori convenzionali, senza alcuna modifica hitechambiente.com/2021/07/21/fan…
Visit our new website - Visitate il nostro nuovo sito quattroseparator.com
quattro Separator team wishes you all health and serenity for the incoming year 2019. Seasons greetings. lnkd.in/dtxzTj7
Work in progress for one of our installations! This time we are working for the food industry. To know how we can be useful in your industrial sector, contact us at: [email protected] #quattroSeparator #decanterentrifuge #industry #foodindustry
Work in progress for one of our installations! This time we are working for the food industry. To know how we can be useful in your industrial sector, contact us at: [email protected]
The week-end is coming and there is nothing better than a beer to welcome it! Find out what quattro Separator can do for beer clarification! Contact us at [email protected]. #quattroSeparator #decantercentrifuge #wastewater #layout #Engineering #beerclarification #yeast
In our decanters, the bearings and the seals are installed outside the separation section. Do you know why this is better? To know more: [email protected] #quattroSeparator #decanter #decantercentrifuge #wastewater #wastewatertreatment #layout #processequipment
Proud to work every day to promote sustainable development for the environment! #quattroSeparator #decanter #decantercentrifuge #wastewater #wastewatertreatment #environment #circulareconomy #recycling #WorldEnvironmentDay
Proud to work every day to promote sustainable development for the environment! #quattroSeparator #decanter #decantercentrifuge #wastewater #wastewatertreatment #environment #circulareconomy #recycling #WorldEnvironmentDay
This is a reality in India as in many other parts of the world. Proud to work every day to promote sustainable development for the environment! #WorldEnvironmentDay facebook.com/quattroSeparat…
Water is our most precious asset, and that's how we make it drinking! If you want to know more, contact us at [email protected]. #quattroSeparator #decanter #centrifugydecanter #water #drinkingwater #Engineering #design
Our visit to #IFAT2018 was as we expected: lively and full of ideas and plans to improve our future. Mission accomplished! #quattroSeparator #decanter #centrifugy #wastewater #wastewatertreatment #sludge #industry #Engineering #Engineer #Munich
Our visit to #IFAT2018 was as we expected: lively and full of ideas and plans to improve our future. Mission accomplished! #quattroSeparator #decanter #centrifugy #wastewater #wastewatertreatment #sludge #industry #Engineering #Engineer #Munich
“Water shortage is a global issue; we have a duty to find sustainable ways to handle this irreplaceable resource. Water treatment plants make a significant contribution to this […]”. Thanks #IFAT2018! That’s why we continue to develop new solutions for our Dewatering Decanters!
What for us is due and simple to obtain, for many others is a conquest. Contact us at [email protected] to receive information on our decanters for wastewater treatment. youtube.com/watch?v=MWVYHC… #centrifugy #decanter #water #wastewater #Engineer #nature #environment
On April 22nd, we celebrated the Earth Day and we want to share with you a principle in which we believe and that guides our job: the #upcycling. To learn more, click on the image (thanks to Intercon for the infographic). #EarthDay #EarthDay2018 #environment
quattro Separator offers the solution for every separation problem. Contact us at [email protected] to receive our information and presentation materials, we will meet your needs. #quattroSeparator #centrifugy #decanter #industry
Decanter quattro Separator in azione per la chiarificazione della molossa dello zucchero: prova superata! youtu.be/XS666B7FV2g #quattroSeparator #decanter #chiarificazione #clarification #centrifuga #centrifuge #factory #plant #work
Auguri per una serena Pasqua dalla squadra di quattro Separator! Da oggi siamo tornati anche su Facebook (link in descrizione). Vi aspettiamo! #quattroseparator #HappyEaster #Decanter #technology #filtration #ecology
Centrifugation/sedimentation market to reach US$7.2 billion in 2015 - Filtration Separation filtsep.com/view/21413/cen…
Separation in the food and beverage sectors - Filtration Separation filtsep.com/view/37008/sep…
coca andrei @cocaandrei2
2 Followers 21 Following
Ibrahim Farouk @hiamato
832 Followers 3K Following شركة روتردام الحيوي لاستشارات الطاقة / الديزل الحيوي البايوديزل Biodiesel Consultant للتواصل بالواتس او الاتصال العادي على هذا الرقم 00201021602609
SeniorCFO @benzersiz_biri
49 Followers 1K Following
PAXMATIC AG @PAXMATIC_AG
45 Followers 85 Following PAXMATIC AG- massgeschneiderte Verpackungsmaschinen und Anlagen aus einer Hand. Zählen, Wiegen, Verpacken - das ist der Kern von PAXMATIC ®.
Lin Yong @LinYong46539824
23 Followers 312 Following
Sardinia Symposium 20... @SardiniaSympo
712 Followers 3K Following 20th International Symposium on #WasteManagement & #Sustainable #Landfilling, 13-17 October 2025, @Forte_Village Resort, Italy #sardiniasymposium
Racors Dewatering pum... @racorspumps
562 Followers 3K Following Dewatering pump companies in India, Dewatering projects, Construction, marine, oil and gas pumps, flood Pumps, Centrifugal pumps, Wellpoint pumps, sewage pumps
ACHEMA worldwide @ACHEMAworldwide
4K Followers 3K Following ACHEMA is the world forum of the process industry and the trend-setting technology summit for the chemical, pharmaceutical and food industry.
cpv-innovation @CpvInnovation
36 Followers 141 Following chemisch-physikalische-verfahrenstechnik Innovative Membranfiltertechnik
Eagle WaterTreatment @eaglewatertreat
392 Followers 495 Following Premium Water Filtration and Treatment Systems. We are Canada's leading distributor of premium made water treatment and filtration equipment.
WasteTech/Вэйст�... @WasteTechShow
670 Followers 2K Following Международная выставка и форум по переработке отходов и природоохранным технологиям ВэйстТэк. 8-10 сентября 2020 в Крокус Экспо, Москва.
Revue EIN @RevueEIN
3K Followers 4K Following L'Eau, L'Industrie, Les Nuisances : Revue technique et professionnelle dans le domaine de l'eau
Three Star Aqua @ThreeAqua
24 Followers 162 Following Three star aqua technology is a water treatment company. Work pales Residency, School, Hospital, medicine factory, food beverage industry , Restaurant, home.
Project Dewatering @project_dewater
1K Followers 4K Following Project Dewatering is a leading specialist dewatering subcontractor, offering solutions to all of your groundwater control needs for any construction project.
Water Clean @WaterClean1
245 Followers 508 Following Industrial Effluent Treatment, Chemical Suppliers, Problem Solvers, Compliance
Jack Ford @JackFordFlood
209 Followers 3K Following Event Director @TheFloodExpo. Proud to be a part of the UK's Flood Community. https://t.co/IPc42QWQem
Cibus Tec @CibusTec
733 Followers 1K Following Cibus Tec 2026 - Food & Bev Tech Exhibition Cibus Tec Forum 2025 - Expo Conference of Food Tech Partner of #Anuga, #Anugafoodtec, #Cibus
Aqua Enviro @aquaenviro
3K Followers 3K Following Conferences and events in environmental science and engineering #wastewater #wastewatertreatment #anaerobicdigestion #bioresources #sludge #biosolids #organics
Idro Group srl @IdroScarl
67 Followers 237 Following Engineering company specialised in water and waste water treatment solutions.
tossudamentalçats �... @betullastrell
61 Followers 378 Following Independentista des de que tinc ús de raó. Ara entenc que el meu avi,andalús i mosso d'esquadra, hagués d'exiliar-se a frança,....
Ahmed Pearce @AhmedPearce213
1K Followers 3K Following
Luke Hallam @Luke_Hallam1
265 Followers 5K Following
Recycling Expo-2018 @RecyclingConf
516 Followers 3K Following 8th World Congress and Expo on #Recycling June 25-26,2018 #Berlin Germany sessions. recycling on #solidwaste #plastic #industrialwaste #thermalwasterecovery
SUD AGRO INDUSTRIES @Salon_Sud_Agro
674 Followers 3K Following SUD AGRO INDUSTRIES, salon dédié aux industries agroalimentaires #agro #Toulouse #agroalimentaire #industrie #services #emballage #SAI2016
BMTS @bmts44
78 Followers 126 Following La société BMTS est spécialisée depuis plus de 20 ans dans la conception, la fabrication et la mise en œuvre de bandes transporteuses et courroies industrielles
Food Magazine.Ma @FoodMagazineMa
433 Followers 354 Following Le magazine professionnel de l'agro-industrie et de la distribution au Maroc
jatin @jatin_beckham
24 Followers 327 Following
Shobha Keshav @jatinbeckham23
26 Followers 396 Following
BulkOilWorldwide @BulkOilWorld
13 Followers 55 Following
José María Gonzále... @JMGJ1966
25 Followers 127 Following #electromecanico #electromechanical #électromécanique
Grove Chemicals @GroveChemicals
543 Followers 1K Following Grove® Advanced Chemicals™ is specialized in water treatment distributing a range of ecological coagulants of plant origin produced from renewable sources.
cpv-innovation @CpvInnovation
36 Followers 141 Following chemisch-physikalische-verfahrenstechnik Innovative Membranfiltertechnik
SPX FLOW @SPXFLOW
2K Followers 748 Following Improving the world through innovative and sustainable solutions
DamagostarGroup @Damagostargroup
37 Followers 214 Following Food And Beverage Turnkey Project Executor Dairy Processing Machinery Builder Automation Implementation
Verpackungsmaschinen @bbv_linien
202 Followers 755 Following Spezialisten für komplette Abfüll- und Verpackungsanlagen. Impressum siehe Homepage.
Alberto Aranda @AlbertoAranda
13K Followers 262 Following Profesor de informática. Fundador de https://t.co/ZQi6Ec1Gxs
Parque De las Ciencia... @ParqueCiencias
60K Followers 563 Following 👉🏻 ¡Prohibido no tocar!👈🏻 Parque de las Ciencias, Andalucía, Granada. Avda. de la Ciencia s/n, 18006 - Granada. 958.131.900 https://t.co/1HQAVveoYt
Food Processing UK @FPeditor
2K Followers 1K Following Food Processing reaches 9,000 processors in the UK. Read our thoughts on the issues affecting food manufacturing in the UK.
TecnA Magazines @TecnA_Magazines
524 Followers 526 Following International Magazines for: Food & Beverage Industry, Plastic & Rubber Industry ♻️ Chemical Cosmetic & Pharmaceutical Industry
Zoho Social @ZohoSocial
111K Followers 184 Following #SocialMediaManagement software for businesses and agencies. Part of the @Zoho suite.
Editrice Zeus @editricezeus
802 Followers 957 Following Magazines and web portal about machines, technology and packaging systems for the food and beverage industry
EATS formerly Process... @EATSformerlyPE
4K Followers 1K Following Equipment, Automation and Technology Show for Food & Beverage | October 28 - 30, 2025 | McCormick Place, Chicago, IL USA | #EATS2025
Duo Group @DuoGroupLtd
733 Followers 326 Following
Ortec Group @OrtecGroup
1K Followers 2K Following Intégrateur de solutions en Ingénierie et Travaux, le Groupe Ortec accompagne les industriels sur l’ensemble du cycle de vie de leurs projets.
GEA Pharma & Healthca... @GEAPharma
3K Followers 331 Following GEA expertise supplies process technologies for Pharmaceutical & Life Science applications. #MakingScienceWork #engineeringforabetterworld #BetterWorldWithGEA
Paul Bocuse - Le Rest... @PaulBocuse
301K Followers 134 Following Bienvenue sur le Twitter officiel du restaurant Paul Bocuse.
Comercio Marruecos @Negocios_Tanger
986 Followers 5K Following Negocios y Comercio Norte de Marruecos España / Región Tánger Tetuán Alhucemas CRTTA y Nador. [email protected]
AZUD Water Solutions @AZUDWater
2K Followers 2K Following Desarrollamos soluciones tecnológicas para la gestión del agua. We manufacture technological solutions for water management.
Eagle WaterTreatment @eaglewatertreat
392 Followers 495 Following Premium Water Filtration and Treatment Systems. We are Canada's leading distributor of premium made water treatment and filtration equipment.
Barriquand TT @BarriquandTT
252 Followers 599 Following Heat exchangers for #Industry and #HVAC, thermal products, #energy recovery solutions. Plate and tubular heat exchangers. French manufacturer.
Xylem @Xylem
14K Followers 870 Following Xylem puts technology to work solving water scarcity, affordability and accessibility. Follow us. #LetsSolveWater
Cibus Tec @CibusTec
733 Followers 1K Following Cibus Tec 2026 - Food & Bev Tech Exhibition Cibus Tec Forum 2025 - Expo Conference of Food Tech Partner of #Anuga, #Anugafoodtec, #Cibus
Sempreinviaggio @Andrea__Monti
5K Followers 4K Following Italiani, Popolo di Santi, Poeti, Viaggiatori e politici corrotti! Fondatore movimento #BastaCazzate e #PDCancroSociale
WETEX @WetexDubai
6K Followers 173 Following 🌍 #WETEX2025: 30 Sept – 2 Oct DWTC At the Forefront of Sustainability 🌍 #ويتيكس2025: 30 سبتمبر - 2 أكتوبر مركز دبي التجاري العالمي
ACHEMA worldwide @ACHEMAworldwide
4K Followers 3K Following ACHEMA is the world forum of the process industry and the trend-setting technology summit for the chemical, pharmaceutical and food industry.
Process.de @Process_de
5K Followers 4K Following Das Portal für Chemie- & Pharmatechnik berichtet über die Wertschöpfungskette der Chemie-, Pharma- und Verfahrenstechnik in den jeweiligen Anwenderindustrien.
ЭКВАТЭК | ECWA... @ECWATECH
729 Followers 3K Following Форум водных технологий №1 в Восточной Европе 8-10 сентября 2020 Крокус Экспо Water Show №1 in Eastern Europe Sept. 8-10, 2020 Crocus Expo 🇷🇺
ENFINITE @liquidrecyclers
144 Followers 108 Following ENFINITE connects, educates, and protects the industrial liquid recycling industry, and adjacent services.
North American Render... @Renderers
1K Followers 1K Following The North American Renderers Association promotes the use of animal by-products. Renderers are the original #recyclers #feed #ag
Ethanol Producer Mag @EthanolMagazine
9K Followers 3K Following Since 1995, Ethanol Producer Magazine has been the trade journal of record for the fuel ethanol industry.
Process Worldwide @ProcessWW
4K Followers 2K Following Process Worldwide covers all aspects of chemical and process engineering. Imprint: https://t.co/tooE5xBA8x
WasteTech/Вэйст�... @WasteTechShow
670 Followers 2K Following Международная выставка и форум по переработке отходов и природоохранным технологиям ВэйстТэк. 8-10 сентября 2020 в Крокус Экспо, Москва.
PetroEnvironment 2022 @PetroEnv
2K Followers 880 Following PetroEnvironment held from 17-18 May 2022, was a 2-day Symposium & Exhibition bringing together leaders and innovators in the energy and environmental industry.
FranceEnvironnement @FrEnvironnement
11K Followers 8K Following FranceEnvironnement est une plateforme spécialisée qui vous informe sur les entreprises de l'Environnement, Air, Eau, Sol, Déchets, Bruit, Mesures...
WaterNetwork @WaterNetwork1
19K Followers 3K Following The largest online community for global water professionals. Connecting innovative and powerful people to solve the global water challenge.
Equitech Bio, Inc. @Equitech_Bio
72 Followers 159 Following Equitech Bio, Inc. is an international supplier of blood and custom antibody products for the biopharmaceutical and diagnostic industries.
Water Technology @WaterTechOnline
22K Followers 729 Following Serving the industrial water treatment industries for more than 30 years.
Processing Magazine @ProcessingMag
10K Followers 2K Following Processing magazine serves the process industries worldwide, including the chemical, food and beverage, pharmaceutical and petrochemical industries.
BtoBeer.com @BtoBeer
846 Followers 1K Following BtoBeer, le Hub des Experts de la Filière Brassicole #bière #brasserie #brasserieartisanale #biereartisanale #microbrasserie https://t.co/vrHZuDvWqy
Revue EIN @RevueEIN
3K Followers 4K Following L'Eau, L'Industrie, Les Nuisances : Revue technique et professionnelle dans le domaine de l'eau
envi.info @EnviInfo
4K Followers 2K Following Periodico online di #Comunicazione #Ambientale | #environmentalcommunication magazine
Aqua Enviro @aquaenviro
3K Followers 3K Following Conferences and events in environmental science and engineering #wastewater #wastewatertreatment #anaerobicdigestion #bioresources #sludge #biosolids #organics
Antonio Poveda @crushandscreen
522 Followers 378 Following
LZZG @Lzzg2014
30 Followers 145 Following
ProcessEquipment @ProcessEquipSA
160 Followers 390 Following The preferred supplier of quality new & used #stainlesssteel equipment for the #food & #beverage, #pharmaceutical & #allied industries.
Idro Group srl @IdroScarl
67 Followers 237 Following Engineering company specialised in water and waste water treatment solutions.
SUD AGRO INDUSTRIES @Salon_Sud_Agro
674 Followers 3K Following SUD AGRO INDUSTRIES, salon dédié aux industries agroalimentaires #agro #Toulouse #agroalimentaire #industrie #services #emballage #SAI2016
How2Go Morocco @How2GoMorocco
256 Followers 899 Following Business #Internationalization & #comex #Internacionalización de empresas y #comercioexterior
Compania AQUASERV @aquaservmures
92 Followers 568 Following Operatorul Regional din judetul Mures al serviciilor de alimentare cu #apa potabila si de #canalizare. #water, #wastewater Pe scurt: Furnizor de #civilizatie!Trends for United States
You might like
