Daemon Sliver @SliverDaemon
a clockwork purple Joined January 2024-
Tweets518
-
Followers29
-
Following427
-
Likes2K
(1/12) Over a year ago, we launched a new project to explore whether the tissue microenvironment could predict cellular behaviour and whether reprogramming might unlock new therapeutic avenues. 🧬 Spatial transcriptomics provides deep insights into tissue organisation. We…
A new study from NYU Langone outlines a potential AI-based method to help track aging cells. The tool assigns a “senescence score” based on nuclear features, which may aid future research in aging and disease. 🧬 Read: doi.org/10.1038/s41467…
Update on a new interpretable decomposition method for LLMs -- sparse mixtures of linear transforms (MOLT). Preliminary evidence suggests they may be more efficient, mechanistically faithful, and compositional than existing techniques like transcoders transformer-circuits.pub/2025/bulk-upda…
We're launching an "AI psychiatry" team as part of interpretability efforts at Anthropic! We'll be researching phenomena like model personas, motivations, and situational awareness, and how they lead to spooky/unhinged behaviors. We're hiring - join us! job-boards.greenhouse.io/anthropic/jobs…
The new single from 'River of Music', 'Handel: Sonata for 2 Cellos', is out now! You can pre-order the album here: KannehMason.lnk.to/RiverOfMusic 🙏🏽 Listen to the new single: kannehmason.lnk.to/HandelSonata
always learn a lot from these posts
always learn a lot from these posts
🚀 Introducing GLiClass‑V3 – a leap forward in zero-shot classification! Matches or beats cross-encoder accuracy, while being up to 50× faster. Real-time inference is now possible on edge hardware. huggingface.co/collections/kn… #TextClassification #NLP #ZeroShot #GLiClass
How challenging is the prediction of transcriptional responses to CRISPR gene perturbations ? A simple model, just scaling RNA correlation vectors, results in accurate predictions for many perturbations. The model is intuitive & grounded in a simple approximation. 1/2
Evo 2 update: new dependency versions (torch, transformer engine, flash attn) and a docker option mean it should be easy to setup without needing to compile locally. Happy ATGC-ing! github.com/ArcInstitute/e…
Here's a video I made breaking down this crazy Echo from the ER #FOAMed
my emotional biotech portfolio: rowansci.com noetik.ai axi.om popvax.com convoke.bio formation.bio markov.bio futurehouse.org newlimit.com leash.bio
Here is a fascinating essay outlining Markov Bio's thesis: foundation models based on observational scRNA data are severely underrated. They got a bad initial reputation, but early models had big problems: too small, weird architectures, and more. markov.bio/research/mech-…
Here is a fascinating essay outlining Markov Bio's thesis: foundation models based on observational scRNA data are severely underrated. They got a bad initial reputation, but early models had big problems: too small, weird architectures, and more. markov.bio/research/mech-…
1/ You're not just sequencing single cells. You're sequencing the soup they're in. Ambient RNA is everywhere in single-cell RNA-seq. Here's how to fix it.
Design Of Intrinsically Disordered Region Binding Proteins @ScienceMagazine 🚀 New paper published from David Baker!🚀 A groundbreaking computational approach has been developed to design proteins that can specifically bind to intrinsically disordered regions (IDRs), which are…
Spatial biology is moving quickly and offers much to be excited about. But there is still a big learning curve. Especially with analysis. If you are a scientist new to spatial techniques, how do you actually analyze your data? A concrete tutorial from prep to insight follows:
Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck! >whatami MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
Source: this tour-de-force in today's Cell cell.com/cell/abstract/…
So, exercise is anti-cancer This is partly because exercise boosts the immune system - killer T cells - and this seems to be because of Formate production by gut bacteria
No MSA? 🔥 No problem🔎 PLAME turns ESM-2 embeddings into virtual MSAs, HiFiAD-filters them and lifts pLDDT +5 on zero-shot CASP14 targets AlphaFold2 accuracy at near-ESMFold latency🔥
Our research on embodied AI agents that can perceive, learn, act and interact in the virtual and physical worlds. #metaAI #AIAgent #embodied #worldmodel #superintelligemce arxiv.org/abs/2506.22355
John Hicks @JohnHicks20420
3 Followers 58 Following
Lynn @prd2brdhd
37 Followers 529 Following
Thomas Abauat @thomasabauat
260 Followers 3K Following
Ubaugoo @Ubaugoo6354928
92 Followers 3K Following
Qije @Qije19184
5 Followers 240 Following
Frances @frances_desjard
346 Followers 3K Following
enZYNe @cyber_chasers
6 Followers 37 Following
Eric Kernfeld @ekernf01
1K Followers 2K Following Statistician and computational biologist; alum @maehrlab, @cahanlab, @alexisjbattle lab. Views are not those of my employer. He/him. https://t.co/jaMuFiHjk0
Ami @ami_newman70
201 Followers 3K Following
Rick Villanueva @rick_villap
149 Followers 679 Following
Nileigh @NileighDSAmN
7 Followers 193 Following
Domain Finder Lab @domainfinderlab
828 Followers 805 Following Find desirable .coms that other people miss https://t.co/qwCcwsojtM
vib @ai_senberg
6 Followers 28 Following journaling my nlp, machine learning, mathematics learning journey (struggling as of now)
Orly Alter @OrlyAlter
2K Followers 2K Following USTAR Assoc. Prof. @UUtah & CSO & Co-Founder, @PrismAIThera peutics, Inc.; @Stanford & @TelAvivUni alumna; my opinions
Brian @brian_cs_
45 Followers 166 Following
Elena @Leana63712911
88 Followers 1K Following 🌟 Dreamer | 📚 Book lover | ☕ Coffee addict | 🎨 Creative soul | 🌻 Sunshine seeker | ✨ Embracing the journey | 📸 Amateur photographer | 🎶 Music enthusiast |
Suzanne @s_principato49
285 Followers 3K Following
artyoung @artyoung
196 Followers 2K Following
Cyberments @cyberments
133 Followers 518 Following You're probably dying. We create clean, specialized supplements for professionals in the tech world.
Thelma @thelmahill79
300 Followers 3K Following
Maurício Faraco @mauriciofaraco
212 Followers 3K Following
DigitalDollarDream @NickRedfield11
277 Followers 3K Following Representing the realm of online retail
VirtualVaultViceroy @gregsummer2007
252 Followers 3K Following Leading the way in lucrative content 🌟"
Claude @claudeai
109K Followers 1 Following Claude is an AI assistant built by @anthropicai to be safe, accurate, and secure. Talk to Claude on https://t.co/ZhTwG8dz3D or download the app.
Brett Adcock @adcock_brett
292K Followers 16 Following Founder @Figure_robot (AI Robots), @Cover_thz (Weapon Detection), @ArcherAviation (NYSE: ACHR), Vettery ($100M Exit)
Jack Lindsey @Jack_W_Lindsey
6K Followers 237 Following Neuroscience of AI brains @AnthropicAI. Previously neuroscience of real brains @cu_neurotheory.
Chemify @ChemifyX
4K Followers 22 Following Turn Code into Molecules & Molecules into Code at scale. chem/acc
Ansu Satpathy @Satpathology
4K Followers 862 Following immunotherapy, genomics, data, cancer @Stanford @Wing_VC @GladstoneInst @CartographyBio @Immunaitech @joinprox @parkerici
Eccles Health Science... @EHSLibrary
2K Followers 669 Following The official account of Spencer S. Eccles Health Sciences Library, @UUtah. We advance and transform education, research, and health care. Questions? Ask us!
Thang Luong @lmthang
27K Followers 95 Following Lead Superhuman Reasoning team @GoogleDeepMind. AI IMO Gold. Co-led #DeepThink, #AlphaGeometry, #Bard (now Gemini) Multimodality, #MeenaBot. LuongAttention.
Mikala Egeblad @megeblad
3K Followers 675 Following Professor at Johns Hopkins University. Working to prevent cancer from spreading and becoming resistant to therapy. @[email protected]
Jose M. Adrover @niseto
1K Followers 2K Following Studying the cancer-cardiovascular disease interplay, with a focus on how cancer reprograms the hematopoietic and immune systems, at the Francis Crick Institute
Asimov @AsimovBio
6K Followers 160 Following Asimov programs living cells to advance the design and manufacture of next-generation therapeutics
Malware Village @MalwareVillage
2K Followers 73 Following Founded by Lena Yu aka @LambdaMamba | Run by World Cyber Health (WCH) Non-Profit | Discord: https://t.co/JE25nRRco6 | Email: [email protected]
Dyno Therapeutics, In... @Dyno_Tx
3K Followers 56 Following Dyno Therapeutics is a pioneer in applying artificial intelligence to gene therapy, focused on AAV capsid engineering. Join our startup: https://t.co/Qw1SEcTjpp
Michał Jastrzębski @_inc0_
649 Followers 715 Following Data enginseer. Navigator of metabolic pathways. Teaching sand to grow bacteria @Ginkgo. Curiosity drives the cat. He/him
Ming "Tommy" Tang @tangming2005
41K Followers 2K Following Director of bioinformatics at AstraZeneca. YouTube at chatomics. On my way to helping 1 million people learn bioinformatics. Also talks about leadership.
Eric Kernfeld @ekernf01
1K Followers 2K Following Statistician and computational biologist; alum @maehrlab, @cahanlab, @alexisjbattle lab. Views are not those of my employer. He/him. https://t.co/jaMuFiHjk0
Eva Miranda @evamirandag
3K Followers 1K Following Chair @la_UPC IcreaAcademia @icreacommunity @adw_goe @unigoettingen @CRMatematica @AvHStiftung @UniCologne living in a "mote of dust suspended in a sunbeam".
Pascale Fung @pascalefung
3K Followers 46 Following Senior Director of A.I. Research, Meta-FAIR. Chair Professor of ECE, HKUST. Fellow of AAAI, ACL, IEEE, ISCA.
MIT Jameel Clinic for... @AIHealthMIT
7K Followers 370 Following The epicenter of AI and health at MIT | Now on BlueSky: https://t.co/Sl6P9xLUH5 | Follow us on LinkedIn and Instagram.
Tamarind Bio @tamarindbio
544 Followers 2 Following Tamarind is a web app and API for the leading protein design tools, trusted by tens of thousands of industry scientists including many global top 20 biopharma.
Changxin Lai @ChangxinLai
26 Followers 70 Following PhD, Healthcare AI & Heart Arrhythmias @trayanovalab @JHU_ADVANCE @JHUBME @JohnsHopkins
Allison G. Hays, MD @AllisonGHaysMD
2K Followers 863 Following Associate Prof of Medicine in Cardiology, Johns Hopkins, wife of heart failure leader + mom of 2, CMR research, Medical Director of Echo, ASE BOD, SCMR past BOD
Lowe Lab @LoweLabMSKCC
6K Followers 192 Following Our lab focuses on genetic changes in cancer and how they contribute to tumorigenesis in the hope of finding therapeutic targets. Tweets from Scott signed -SWL.
DBMI at Harvard Med @HarvardDBMI
7K Followers 654 Following Department of Biomedical Informatics at @Harvard/@harvardmed: #datascience- & #AI/#ML-powered models of clinical care to advance human health. Chair @zakkohane.
Ari Wagen @AriWagen
1K Followers 544 Following building the arsenal of discovery for drugs & materials @RowanSci, anti-gnostic
Maha Farhat @MahaFarhat
2K Followers 1K Following Physician Scientist @HarvardDBMI @MGHMedicine. tuberculosis, evolution, antibiotic resistance, AI/ML, genomics, translational research, public health
Marinka Zitnik @marinkazitnik
8K Followers 226 Following Associate Professor at Harvard | Faculty @Harvard @KempnerInst AI | Faculty @broadinstitute @harvard_data | @ProjectTDC @AI_for_Science
Bo Wang @BoWang87
13K Followers 2K Following SVP and Head of Biomedical AI @Xaira_Thera; Associate Prof @UofT; Chief AI Officer @UHN; former PHD, CS @Stanford; opinions my own. #AI #healthcare #biology
Netflix Research @NetflixResearch
11K Followers 72 Following
The Green Journal @greenjrnl
30K Followers 510 Following Obstetrics & Gynecology (the Green Journal) has been the official publication of the American College of Obstetricians and Gynecologists since 1953.
Foresite Labs @ForesiteLabs
330 Followers 85 Following A center for entrepreneurial innovation at the intersection of AI and data science
Abhinav Adduri @abhinadduri
398 Followers 206 Following ML Research Scientist @ArcInstitute. CS Ph.D. @CarnegieMellon.
Ann Huang @_annhuang
115 Followers 99 Following i like science and cats. bioinformatics @xaira_thera
XairaTherapeutics @Xaira_Thera
907 Followers 21 Following An integrated biotechnology company driving advances in artificial intelligence to learn the language of life and transform how we treat disease
Orion Weller @orionweller
2K Followers 947 Following PhD student @jhuclsp interning @AIatMeta FAIR. Prev intern @GoogleDeepMind, @samaya_ai, @allen_ai. Research: LLMs, RAG, and IR
Anna E. Beaudin @BeaudinLab
2K Followers 1K Following Prof of Medicine & Assoc Chief of Basic Research @UofUHematology @UofUInternalMed @UU_MolecularMed @UofUMandI Hematopoiesis, immunology, development
Atoosa Kasirzadeh @Dr_Atoosa
3K Followers 2K Following societal impacts of AI | Asst prof @CarnegieMellon | system engineering + AI + philosophy | all views my own
Yale School of Medici... @YaleMed
162K Followers 891 Following The official Twitter feed for Yale School of Medicine, a world-renowned center for biomedical research, education, and health care founded in 1810.
Sam Kriegman @Kriegmerica
3K Followers 428 Following Assistant professor of computer science, chemical and biological engineering, and mechanical engineering @NorthwesternU.
Conor McClune @conor_mcclune
451 Followers 642 Following @DamonRunyon Postdoc @Stanford with @Sattely_lab & @fordycelab Plant chemistry, synthetic biology, and everything in between. Formerly Voigt & Laub labs @MIT
Ayan @ayanobacter
562 Followers 283 Following PhD in Synbio, Entrepreneur, Open Science, Researching and Writing About Futures and Frontiers
Chaitanya K. Joshi @chaitjo
9K Followers 973 Following PhD student @Cambridge_CL. Research Intern @AIatMeta and @PrescientDesign. Interested in Deep Learning for biomolecule design.
Kevin Ellis @ellisk_kellis
2K Followers 176 Following Cornell Computer Science, Assistant Professor. Program synthesis, AI
GAMA Miguel Angel �... @miangoar
1K Followers 1K Following Biologist that navigates in the oceans of diversity through the space-time | MSc in Biochem/Bioinfo @ibt_unam 🇲🇽 | Protein evo, metagenomics & AI/ML/DL
Jia (Jenny) Liu MD Ph... @JiaJennyLiu
1K Followers 864 Following Early Phase Trials Medical Onc Translational Researcher @kinghorncancer SVH Sydney @CMRI Senior Lecturer @UNSW. MOGA Exec. #PrecisionMedicine #drugdevelopment
Broad Institute @broadinstitute
99K Followers 4K Following A multidisciplinary community of researchers on a mission to improve human health.Trends for United States
You might like
