Vic's Vegan Food reviews @VickyHu48652273
Vegan product reviews and recommendations. Reviewing vegan food products in the UK supermarkets. A vegan life is easier than ever. #vegan UK Joined November 2019-
Tweets17
-
Followers148
-
Following295
-
Likes42
Looking forward to trying these on the campfire next week 😋🌱💚
Looking forward to trying these on the campfire next week 😋🌱💚
Had these #vegan @nakedgloryuk sausages with mash and gravy and enjoyed the meal. Positive reviews elsewhere but I would prefer the @RichmondFoods sausages I reviewed last week.l to these. Do give them a try £2.75 @Tesco ✌🏽❤️
I enjoyed this vegan kebab from @asda for £2.99. ✌🏽❤️
Time for a @sainsburys review. The vegan ribz were nice and at £3.75 for eight pieces are pretty good value. Served here with Sainsbury’s Roasted vegetable pasta, £1.80 and Sainsbury’s spiced roasted cauliflower at £2.00. A plethora of taste ✌🏽❤️.
If you're still drinking cow's milk, it's time to give vegan milk a try. Sample a few brands and you'll surely find one whose taste you prefer to cows' milk. vegan.com/vegan-milk/
What a job! Delicious burgers from @Morrisons V taste range. £1.50 a box. One of my favourite #vegan burgers that I’ve tried so far. ✌🏽❤️
These 2 for £5 @Morrisons own V taste Paellas were quite nice. Served with @asda potato pops, spinach, garlic bread and tomatoes.I found it a little sticky but overall still enjoyed my meal.
What can I say? Absolutely delicious, well done @RichmondFoods 👍🏼 I opted for them with @Warburtons seeded batch vegan bread, toasted with cooked tomatoes. Sausages were difficult to get out of packet but once that minor task was achieved a very enjoyable vegan butty. ✌🏽❤️
In the oven. Review to follow, dilemma is toast or a barm. Purchased from @asda for £2.50 and widely available elsewhere at other supermarkets.
Ok Fellow vegans here it is, my first review. This vegan hosomaki from @Morrisons is delicious At £2 this gets eaten as soon as it’s out of the shopping bag. The only fish here is the little plastic squeezy one containing the soy sauce. ✌🏽❤️
Hello and welcome to Vic’s vegan food reviews. Standby for the first ever review on this new page. ✌🏽❤️
thestickchef @thestickchef
62 Followers 94 Following Welcome, friends! We're here to share our reviews, recipes, and all things good food-related!
youngsuk @youngsuk6904
5 Followers 30 Following
Savorful Wanderlus tL.. @LifeSavorf40641
547 Followers 3K Following Wandering Eaters 😋 🍔🌮Digital Creator 🌮🍔 DM 💬For your Restaurant Review & Collaboration We try the best foods in the best restaurants.
Fresh vegan online @Freshveganlife
704 Followers 3K Following https://t.co/jzUsSx7QPW is a Vegan recipe website dedicated to providing delicious Vegan recipes you can make at home
The Herbalist @TheherbalistDr
179 Followers 589 Following Herb is the name and an herb specialist is my game. My mission is to incorporate excellent nutrition with an active lifestyle, healing herbs are best, ebook now
onastoolatabench @OASAAB_reviews
33 Followers 205 Following Welcome to "On a Stool at a Bench" - your guide to Hobart's booming cafe and restaurant scene! Join me as I discover the newest and most exciting places to eat.
Kenan King @nileveganfood
6 Followers 36 Following
VegOut West @vegoutwest
1K Followers 5K Following Vegan festival in west Wales 19th - 20th August 🏴 facebook https://t.co/yBNRgybrL4 tickets https://t.co/ibirejXny0
Super-Supplement @ChongHeeChoon4
482 Followers 4K Following We are Super Supplement is a supplier food supplements, herbal formulations, organic health foods. Trading since 2014,
Heardsmen Foods @The_Heardsmen
360 Followers 475 Following YouTube content creators. Having a blast sharing what they love!
Vegan's Friend Ⓥ @VegansFriendApp
835 Followers 1K Following VegansFriend was designed to help meet the needs of a growing vegan movement. Become part of the community and start benefiting from meal planning today.
JDNfromBrooklyn @JDNfromBrooklyn
147 Followers 595 Following Recipes, home remedies, botanic herbal healing and life hacks. From Brooklyn, of Cuban and Jamaican decent, I got the spice for your life 🇨🇺🇯🇲🪴🌶️🌽🥧🍳
claire perrin @claireperrin7
311 Followers 1K Following Expert Life Mixologist. Chemical and toxic free. 🌱 And still I rise. 🙌🏾 No apologies. Views represent my own.
fallon💸 @twootimesss
189 Followers 401 Following vintage reseller | Insa : twootimesvintage | i’m a vegan girly 🌱 cincinnati, oh 📍27 🇵🇷 My wife : @toriraheann
BygTaste Views @bygtaste
112 Followers 610 Following BygTaste Views is my new YouTube Channel. I'm a hungry traveler that's, eating as much delicious food as I can. I will always try to fill the channel's video
Little Vegan @LittleVeganUK
345 Followers 592 Following 🎉 Book us for occasions big or small | 🗺 Find us at events across Lancashire | 🍔 Discover our tasty veganised food | 💚Help us spread the #Vegan love.
almashealthycooking @almashealthyck
2K Followers 4K Following Healthy living starts with healthy cooking. Follow me for more recipes on Instagram and Youtube https://t.co/3wPxNaQwbR…
GoClimateAction @ClimateGo
891 Followers 3K Following Offset your carbon footprint with certified carbon reduction projects. GoClimateAction - we are running out of time!
Lisa La Rochelle @lisaalarochelle
404 Followers 1K Following Vegan. Foodie. Soccer Obsessed. Traveler. Serial Entrepreneur. #inspire
EAT WORKS @eat_works
1K Followers 3K Following I love to cook, cooking is my passion. In fact I have my first video on my YT Channel. https://t.co/Mf76x6PB2z ?sub_confirmation=1
Sheep Ahoy Rescue @olisgang
3K Followers 3K Following Registered Charity & Vegan Sanctuary for abused or abandoned Sheep 🐑 & Goats 🐐 - We are putting right to what humans do wrong..
Arthur @arthursdug
1K Followers 4K Following Musicrunningdugswalkingvegancyclinggymchesspoliticsmountainsbeercarslaurelnhardysnowboardingmorerunningthe smoutgardeningmorerunningradiopresenter
👑🌱 Princess Pla.. @JDorPrincess
423 Followers 3K Following 🌱EAT MORE PLANTS🌱 🍓🍒🍎🍉🍊🍍🍌🥝🥕🍅🌽🥦🥒🥑. I ❤️ BOOKS ❤️ especially #AmeliaPeabody🌂📚 #HarryPotter #CBStrike #PercyJackson
Neil Martin @NeilNotNiel16
900 Followers 5K Following Vegan, Remainer, getting slowly over heart attacks, strokes, and a worse spinal/brain growth. Lib-Dem, equality for all ages, sexes & ethnicities. Very CORNISH!
vevibes.com @vevibes_com
16 Followers 62 Following Online Vegan store | Plant-Based food | Free-From range | Meat alternatives! Check us out! #veganfood #veganproducts #glutenfree #plantbased #plantbaseddiet
Lesley Flounders🌹�.. @lelflo1
934 Followers 2K Following Citizen of the World. Mother of two. Socialist. INTJ. 🎪 #writerscommunity #NFFC She/Her
Southern Vegan Yankee @SouthVegYankee
216 Followers 454 Following Hi. I am a happy new vegan. I am writing about my vegan journey in my new blog, Southern Vegan Yankee.
Stingray174 🇿🇼�.. @Zimmedz
950 Followers 1K Following Vegan🥑🌱. I love music and i loooove people! If you bring good vibes then tune in☺🙏💚. I'm into healthy living. 💪🏿. Northwest 🇬🇧
Healthliners 🍎🏃.. @healthliners
476 Followers 2K Following Bespoke service offering personalised programmes on: -Weight Loss 🏋️♂️ -Improved Fitness 💪 -Sleep Quality 😴 -Mood Enhancement 😄 -Reduce Risk of Disease 🍏
Xenex-Foods @FoodsXenex
19 Followers 221 Following https://t.co/Airb3iXCYU is a family run, unique online multi-country UK grocery store specialising in British made produce delivered directly to your door.
Thiago Alves @th_audiovisual
136 Followers 2K Following
Joanna Dunne @Graziellajune
2K Followers 5K Following A vegan who absolutely adores animals. Fight for animal rights in a massive way. Also environmental issues.
Leesekisses @leesekisses
31 Followers 131 Following Vegan/organic & natural lip gloss, lip balms and lip scrubs
WhiteSnow AngelDove �.. @AngelDoveCross
830 Followers 4K Following #peace ☮ #dove 🕊 #angel😇 #snowcrystal ❄Ⓥ #libera #TimeTravel #holistic #CrueltyFree #GoVegan #nonGMO #脱搾取 #脱原発 #永世中立 #護憲 #マクロビ #無農薬 #薬害撲滅 #誹謗中傷撲滅
Theveganspecialists @Theveganspecial
149 Followers 249 Following Indulge in to the encyclopedia of Vegan information, recipes, tips&tricks and many more..
Recipe By Nargis @recipebynargis
225 Followers 143 Following Description Welcome everyone💖 I’m Nargis Biswas🦋recipe by nargis🌟💖 is my cooking channel ✨ i love food & i love cooking that's why i am trying.
CarolLeeUK @CarolLeeUK
137 Followers 592 Following Runs Vegan B & B on the beautiful Isle of Arran with husband Jules. Vegan for the animals, for health, for the climate, for everything really.
SparkleBrightⓋ ⭐�.. @ConciousVegan
6K Followers 5K Following 🎂 Vegan cake is not poison 🎂 (But the animal agriculture industry is) Lover of animals, Baker, Singer, Occasional Minecrafter 🎶🎂💜✌️ 🌱 (19)
bernardtheplantbasedo.. @bernardtheplant
124 Followers 499 Following An owl who's bored of eating my vole friends, so I'm trying #plantbased instead - with food inspired by Dr Greger's, Campbell's & Ornish's research, Hoot, (o,o)
Inspirational Quotes .. @wordsinspirejoy
1K Followers 4K Following The best inspirational quotes & videos to bring joy into your life! Peace and love to all! Sharing #peace, #love, #art, #animals, & all around good feelings.
Refreshing Smoothies @RefreshingSmoo1
8 Followers 87 Following Healthy Smoothie Recipes • Simple vegan and plantbased recipes 🌱 • Sugar free • oil free • glutenfree @refreshingsmoothie on Instagram
vegideal @vegideal
3K Followers 4K Following Ethical vegan. Join our youtube channel. News, info, recipes, tips, ideas, books and a lot more to share! #GoVegan #vegan #authenticitalianrecipes #crueltyfree
Marlis Moyer Ⓥ 💯.. @mmmoyer
2K Followers 4K Following VEGAN FOR THE ANIMALS! 🐄🐖🐑🐓 #AnimalActivism ✊ #AnimalLiberation ✌️ #AntiSpeciesism ✋ German native living and thriving in Canada!
London Vegan Meetup @VeganMeetup
3K Followers 4K Following Want to meet people in London? Enjoy great vegan food? Then join the world's largest vegan social group (apparently!) Non-vegans welcome. And it's free!
Wannagoferal @wannagoferal
2K Followers 2K Following 🌱Vegan🌱Atheist🌱Minimalist... Animal abuse is morally reprehensible and goes against the principles of compassion and empathy.
Marek Beatlemarek🇪.. @Beatlemarek
605 Followers 799 Following Jestem ateistą, apostatą, weganinem, emerytem, Europejczykiem i Ziemianinem. Peace, Love & Freedom. I invite you to Beatleland: https://t.co/XIz2pqyDyy
steve beetson @steve_beetson
73 Followers 321 Following
One Billion Vegans @OneBillion_co
10K Followers 9K Following Join Now the Campaign to Create One Billion Vegans Worldwide by Year 2022
Uh Lee See Uh Ⓥ @Aliciaeatsvegan
554 Followers 299 Following Vegan for the animals. Just playing some video games
🌈𝔥𝔞3 ✌️ @mXdFoci
1K Followers 3K Following ɛŋıɠɱąɬıƈ💫 Bi💘 𝒑𝒐𝒍𝒚🐦 #autism #edtech + #sustainability @KingsCollegeLon @TheVeganSociety 𝐯𝐨𝐥𝐮𝐧𝐭𝐞𝐞𝐫 · #aerospace & #altprotein buff
TheVainVegan @TheVainVegan1
167 Followers 238 Following 🌱Plant based 🏃🏿♀️Runner #HalfMarathoner 🚴🏿♀️Peloton-er #Health #Wellness 💁🏿♀️Anti-Ager 🤣 #BenjaminButtonOnTheseBitches IG: @TheVainVegan
SparkleBrightⓋ ⭐�.. @ConciousVegan
6K Followers 5K Following 🎂 Vegan cake is not poison 🎂 (But the animal agriculture industry is) Lover of animals, Baker, Singer, Occasional Minecrafter 🎶🎂💜✌️ 🌱 (19)
Get Vegan Grub @getvegangrub
114 Followers 181 Following Local . Cruelty-free . Easy . We are a UK-based cruelty-free platform to order vegan food. We are an ethical alternative to Deliveroo, Just Eat & Uber Eats
Thiago Alves @th_audiovisual
136 Followers 2K Following
Reiki Hippy@Heart ❤.. @Helen88403583
85 Followers 316 Following 🌟Reiki attuned to Level 2, working on my Masters 🙏🕉️ 🌟LOA 🌍 🌟Peace ☮️ Love ❤️ & Harmony ☯️ is my mantra ✌️
sahjalal sayem @SahjalalSayem
83 Followers 409 Following
Rewild Clothing Ⓥ @Rewild_Clothing
386 Followers 1K Following Rewild Clothing, Rewild Your Life - Ethical | Organic| Vegan | Circular | Beautiful
syedabdullah @syed31154
110 Followers 2K Following
TheRed Killer ❤️ .. @theredhedgehog
370 Followers 839 Following NFT & Crypto Trader 🔥| Drop your nft 👇 #NFT Collector | DM me to promote your project 💎 +500K Network #Metaverse
KG @KLGT88
354 Followers 1K Following
Dionne Short @Dees29Short
12 Followers 87 Following
Mrs Woollie #FBPE �.. @Eiriol2
10K Followers 10K Following #FBPE #EnoughisEnough ADHD♥️LGBTQi+Ally🏳️⚧️🌈Cymraeg #VEGAN🌱Ⓥ Annibyniaeth RejoinEU Proud WOKE #HateTheTories
Scot-free🏴.. @scotfreee
2K Followers 5K Following Compassion for the conned, contempt for the conmen ☮️ I believe in Scotland #indyref2 #ScottishIndependence #StirlingDirective #FreePalestine🇵🇸
Vaughan Nicholls @nicholls_v
654 Followers 2K Following Ex-submariner Anchorite,Opossum & retired doctor. Parent to aboriginal kids in Saskatchewan, Canada. Animal lover. Aging athelete. worcester🇬🇧
TOKYO VG+GF @tokyo_vg
239 Followers 545 Following We are TOKYO VG+GF, a FREE portal site to introduce Vegan, Vegetarian and Gluten-free meals in Tokyo for your visit!! For everyone who needs to find them there!
david haines @happyfatbadger
139 Followers 102 Following pharmacist in swansea. 6 fab kids. blah blah etc see me on fb coz it's so much easier than this twitter lark!
Panda Roll @uk_roll
50 Followers 404 Following Sustainable comfort at a great price. Our Tissue products are 100% Natural Bamboo, 100% Plastic FREE, 100% B.P.A FREE, 100% Vegan and are Launching in 2020.
PlantIvy @PlantIvy1
152 Followers 346 Following Hi! Plant Ivy is a vegan/vegetarian food truck serving exclusively impossible burgers to the Central Coast, California!! We’d love to serve you!
Cruelty Free Blog @Go_Cruelty_Free
392 Followers 21 Following My tweets are for all animal lovers who are against animal cruelty. Share your tweet, video, etc and spread the message of animal love and support. Be with us.
Clark Linda 🌱 @ClarkLi91747
2K Followers 2K Following GLOBAL CLIMATE CRISIS #1, ETHICAL VEGAN ; BAN ALL GUNS; FULLY VACCINATED! SERIOUS PERSON; NO DMS
Vegania Lifestyle @VeganiaLifesty1
114 Followers 330 Following Vegania Lifestyle is community that is all about healthy and juice vegan lifestyle and aims to promote veganism in all its different aspects and way beyond.
More Vegan Memes Ⓥ @moreveganmemes
37 Followers 1 Following Instagram: https://t.co/Vbfc97V9Sr 🔁 Tweetin' Everyday 👐 Retweet & Share with your friends
Mamma! @MammaShortFilm
15 Followers 81 Following After all animals have gone extinct due to factory farming, Riley must risk her life to save female prisoners enslaved on a dairy farm.
Protein For Vegans @Protein4vegans
20 Followers 22 Following Best source of Proteins for Vegans 🌱 All the info you will need to find food suitable for Vegans 🥗
Veggie Barna @VeggieBarna
77 Followers 186 Following Ets vegetarià i no saps on anar a menjar per Barcelona? Nosaltres t'ajudem a decidir-te!🌱🍽 Entra al nostre web i troba tot tipus d'establiments vegetarians.
Homemade Vegan|家常.. @ireneyong168
248 Followers 724 Following Who equip easy and inspiring vegan recipes.
Carole Mason @iamcarolemason
4K Followers 4K Following Food writer, Author of Mae's Ancient Thai Food.
Rhian's Recipes - Veg.. @rhiansrecipes
1K Followers 17 Following Easy, undetectably #vegan #glutenfree recipes! Healthy comfort food and naturally sweetened desserts using simple, plant-based ingredients. 📍Tokyo, Japan
woo100 ☮️ #MIPO @Woo100
2K Followers 591 Following MA Art History. MA Education. Anti bloodsports. Ethical Vegan. Diagnosed “ME” 2005. UK Republican. Dyslexic - expect missing words/letters.
MarkK3rr @Markk3rr
489 Followers 694 Following First powerwall Tesla UK owner. Vegan friendly, EV enthusiast, solar PV eco warrior, love my industry and love my job, love all animals and love my planet.
Elin Hall Evans @elinhallevans
248 Followers 1K Following Siarad Cymraeg. Veggie. Love laughs, being outdoors, food & drink + the arts etc. All views my own!
Emily Dyson @edyson_90
562 Followers 1K Following Deputy Director @IVAR_UK. Trustee @taketheJUMPnow. Vegan foodie & keen baker. Married to a musician @JoeHawkes. All views my own.If you're still drinking cow's milk, it's time to give vegan milk a try. Sample a few brands and you'll surely find one whose taste you prefer to cows' milk. vegan.com/vegan-milk/
@VickyHu48652273 @Morrisons They're our little one's favourite too!
These tasted just like fishcakes. Not sure how I feel about this... ...or what I expected really...?? 🤔👍🌱
Recipe: #Vegan Lentil Soup with Turmeric & Ginger thevegspace.co.uk/?p=8834&utm_so… #recipe #Veganfood
Guess what I miss being vegan? NOTHING! #vegan
Looking forward to trying these on the campfire next week 😋🌱💚
What can I say? Absolutely delicious, well done @RichmondFoods 👍🏼 I opted for them with @Warburtons seeded batch vegan bread, toasted with cooked tomatoes. Sausages were difficult to get out of packet but once that minor task was achieved a very enjoyable vegan butty. ✌🏽❤️
Hey @VickyHu48652273, Thank you for the follow!
Our UK petition to see good and nutritious vegan meals on every public sector menu is still collecting signatures - sign and share to get your voice heard! #UKVegan #Vegan #PlantBased #Petition #UKGovernment petition.parliament.uk/petitions/2280…
The sad truth is that people are more likely to go #vegan for selfish reasons than for ethical reasons.
Ok Fellow vegans here it is, my first review. This vegan hosomaki from @Morrisons is delicious At £2 this gets eaten as soon as it’s out of the shopping bag. The only fish here is the little plastic squeezy one containing the soy sauce. ✌🏽❤️
Vic's Vegan Food reviews Thank you for following me!!
If you're a pav-'lover', look no further than this #vegan recipe: bit.ly/2NUP7zU
Three very wet and soggy Badgers tonight and Mr Lumpy was very Grumpy 😱😆🐾🐾🐾🐾🐾🐾❤️🥰
So after being shocked to my core last night watching #GameChangers I decided at nearly 37 years old and 18st 7lbs I needed to listen to what I had just heard. So after my 1st day on a #plantbasedfood diet I have just done my 1st #plantbasedfood shop & cooked my first meal #tasty
The Game Changers on Netflix just made me go vegan.
Good news for all the Beef eater , meat lover and Mutton crazy people ! There is a mouth watering treat awaits you on Netflix called “The Game Changer “ . Plz watch and savour it ! It will change your thinking and later on your life !
Trends for United States
You might like
